Identification and Expression Analysis of a Flavonoid 5-O-glucosyltransferase Gene in Paeonia delavayi
《北方园艺》[ISSN:1001-0009/CN:23-1247/S]
- Issue:
- 2018年14
- Page:
- 102-108
- Research Field:
- Publishing date:
Info
- Title:
- Identification and Expression Analysis of a Flavonoid 5-O-glucosyltransferase Gene in Paeonia delavayi
- Author(s):
- YUAN Xiaolong; CHEN Jian; CHEN Zhonghua; HUA Mei; WANG Yi
- (Yunnan Provincial Key Laboratory of Cultivation and Exploition of Forest Plants,Yunnan Academy of Forestry/Key Laboratory for Conservation of Rare,Endanger & Endemic Forest Plants,State Forestry Administration,Kunming,Yunnan 650201)
- Keywords:
- Paeonia delavayi; glucosyltransferase; cloning; gene expressing analysis
- PACS:
- -
- DOI:
- 10.11937/bfyy.20174499
- Abstract:
- Paeonia delavayi was used as experimental materials,we cloned a full length of flavonoid 5-O-glucosyltransferase([STBX]Pd5GT[STBZ]) gene from P.delavayi firstly with the method of RT-PCR,which has a whole opening reading frame,and used the bioinformatics and transcriptional pattern to analyze [STBX]Pd5GT[STBZ] gene.The results showed that the C terminal of Pd5GT protein had PSPG box,and its amino acids sequence was WCSQVEVLSHPSLGCFVTHCGWNSTTESLVCGVPVVAF PQWTDQGT NAKL,and clustered together with 5GT known their function;[STBX]Pd5GT[STBZ] gene was strongly expressed in flower,slightly in stem and leaves,and strongly expressed in different color petals.In conclusion,[STBX]Pd5GT[STBZ] gene could encode 5-O-glucosyltransferase,had some tissue-speciality but flower-color-speciality wasn′t obviously.The present study would provide theoretical basis for the study of mechanism of flower pigment biosynthesis in P.delavayi,for the identification of the function of glucosyltransferase in P.delavayi,and for improving flower quality by genetic engineering.
Last Update: 2018-08-20